Cart 0
Hsp90 Recombinant Protein

Hsp90 Recombinant Protein

$250.00
Product Name Hsp90
Reference Number BB-004
Description Hsp90 gene was obtained from Borrelia burgdorferi strain B31. Hsp90 was then cloned and produced in E.coli. Protein has N-terminal His-tag.
Source Escherichia Coli
Vector pET-28a(+)
Size 71 kDA
Purification Method Proteins are purified using standard chromatography techniques. Proteins will be shipped in a buffer containing 50mM Sodium Phosphate, 0.3M NaCl, and 250mM Imidazole. Desalting is available upon request.
Storage Recommended short-term storage in 4*C, long-term storage (greater than 1 week) in -20*C.
Amino Acid Sequence

MKKQFDTEVNDLLYLIIHSLYSHKEIFLRELISNASDAIDKLKFLSLTNE
KFKNIALEPKIEISFDDKSILIKDNGIGMDEQDLTNHLGVIAKSGTKEFI
NNLKQDEKKSASLIGQFGVGFYSAFIVSEKVEVTSKKALESDAYIWSSDG
KTGYEIEKAKKEESGTEIKLYLNKEGLEYANKWKIQEIIKKYSNHINYPI
YIKYSEPIMKDGKQEGIEEKEEKLNETTALWTKNKSEIKAEEYNEFYKNT
TFDYENPLMHIHTKAEGNLEYTNLFYVPSKAPYDLYYPNTKPGVKLFINR
IFITDSEGSLLPNYLRFIKGIIDCQDLPLNVSREILQQNKILSKIKSSSV
KKILSELEKLSKKNPEKFSEFSKEFGRCIKEGVYSDFENREKLISLIRFK
SSSVDGFVSFKEYKERMNESQKSIYYITGGKENILKENPIVAAYKEKGFE
ILIMDDELDEAILNLIPEYEGLKLKAINKNETSNELKDENFKKIEEEFKD
TLTKVKEILKDHIKEVNLSATLIKEPSAIIIDSNDPTYQMQKIMLSMGQE
VKEIKPILELNPNNKIVQNLKNLEPEKLEKISILLFEEAMLTSGMPSKNP
GKFINIINEFIEKDFL

Purity

Protein purity is checked by SDS-page and Western Blot.

Usage

Proteins purchased from Immuno Technologies, Inc. are for laboratory research use only.


Share this Product