Cart 0
p28 Recombinant Protein

p28 Recombinant Protein

$250.00
Reference Number BB-002
Description p28 is a surface lipoprotein. The p28 gene, also referred to as MlpA was obtained from Borrelia burgdorferi strain B31. p28 was then cloned and produced in E.coli. Protein has an N-terminal His-tag.
Source Escherichia Coli
Vector pET-28a(+)
Size 16 kDA
Purification Method Proteins are purified using standard chromatography techniques. Proteins will be shipped in a buffer containing 50mM Sodium Phosphate, 0.3M NaCl, and 250mM Imidazole. Desalting is available upon request.
Storage Recommended short-term storage in 4*C, long-term storage (greater than 1 week) in -20*C.
Amino Acid Sequence

MKIINILFCLFLLLLNSCNSNDNDTLKNNAQQTKSRGKRDLTQKEATPEKPKSKEELLREKLSEDQKTHLDWLKEALGNDGEFDKFLGYDESKIKTALDHIKSELDKCNGNDADQQKTTFKQTVQGALSGGIDG

FGSNNAVTTCGNGS
Purity

Protein purity is checked by SDS-page and Western Blot.

Usage

Proteins purchased from Immuno Technologies, Inc. are for laboratory research use only.


Share this Product